The PTEN_C2 domain within your query sequence starts at position 251 and ends at position 390, and its E-value is 5.95e-42.

PHFKPLTIKAITVSPVPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVIVSMYHLRSTIGSRLQAKVTNTQIFQLQFHSGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDIEV
PTEN_C2

PTEN_C2

C2 domain of PTEN tumour-suppressor protein
SMART ACC:SM001326
Description:This is the C2 domain-like domain, in greek key form, of the PTEN protein, phosphatidyl-inositol triphosphate phosphatase, and it is the C-terminus. This domain may well include a CBR3 loop which means it plays a central role in membrane binding. This domain associates across an extensive interface with the N-terminal phosphatase domain DSPc (Pfam PF00782) suggesting that the C2 domain productively positions the catalytic part of the protein onto the membrane (PMID:10555148).
InterPro ACC:IPR014020
InterPro abstract:

Tensins constitute an eukaryotic family of lipid phosphatases that are defined by the presence of two adjacent domains: a lipid phosphatase domain and a C2-like domain. The tensin-type C2 domain has a structure similar to the classical C2 domain (see IPR000008 ) that mediates the Ca2+-dependent membrane recruitment … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 056 PTEN_C2 domains in 6 045 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTEN_C2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTEN_C2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTEN_C2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTEN_C2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPTEN_C2
InterProIPR014020