The C345C domain within your query sequence starts at position 516 and ends at position 625, and its E-value is 5.58e-25.

PKAFCGMKYSYVLKIKILSAHDKGSHAEVNVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVRTGKLIVNMKSFVQHWKPALGRRVMHILKR
C345C

C345C

Netrin C-terminal Domain
SMART ACC:SM000643
Description: -
InterPro ACC:IPR018933
InterPro abstract:

The netrin (NTR) module is an about 130-residue domain found in the C-terminal parts of netrins, complement proteins C3, C4, and C5, secreted frizzled-related proteins, and type I procollagen C-proteinase enhancer proteins (PCOLCEs), as well as in the N-terminal parts of tissue inhibitors of metalloproteinases (TIMPs). The proteins harboring the NTR domain fulfill diverse biological roles ranging … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 227 C345C domains in 4 219 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C345C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C345C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C345C domain which could be assigned to a KEGG orthologous group, and not all proteins containing C345C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamNTR/C345C module
InterProIPR018933