The ZP domain within your query sequence starts at position 361 and ends at position 568, and its E-value is 1.29e-2.

PKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSM
ZP

ZP

Zona pellucida (ZP) domain
SMART ACC:SM000241
Description:ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).
InterPro ACC:IPR001507
InterPro abstract:

The zona pellucida (ZP) domain is a protein polymerisation module of ~260 amino acid module, which is found at the C terminus of many secreted eukaryotic glycoproteins that play fundamental roles in development, hearing, immunity, and cancer [ PUBMED:1313375 PUBMED:12021773 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 14 185 ZP domains in 14 113 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZP domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001507
PROSITEZP_DOMAIN
Pfamzona_pellucida