The DUF167 domain within your query sequence starts at position 32 and ends at position 108, and its E-value is 3.17e-28.

PKGFVTIAIHAKPGSRQNAVTDLSTEAVGVAIAAPPSEGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLA
DUF167

DUF167

SMART ACC:SM001152
Description: -
InterPro ACC:IPR003746
InterPro abstract:

This entry describes a group of proteins of unknown function found in all cellular organisms. Structures for two of these proteins, YggU from Escherichia coli and MTH637 from the archaea Methanobacterium thermoautotrophicum, have been determined; they have a core 2-layer α/β structure consisting of β(2)-loop-α-β(2)-α structural elements [ PUBMED:12975589 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 584 DUF167 domains in 8 582 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF167 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF167 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DUF167 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF167 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF167 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003746
PfamDUF167