The HMG domain within your query sequence starts at position 567 and ends at position 635, and its E-value is 2.54e-14.

PKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVK
HMG

HMG

high mobility group
SMART ACC:SM000398
Description: -
InterPro ACC:IPR009071
InterPro abstract:

High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 46 627 HMG domains in 39 088 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HMG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HMG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the HMG domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HMG domain.

ProteinDescriptionDisease / phenotype
SRY_HUMANOMIM:480000 : Gonadal dysgenesis, XY type
SOX9_HUMANOMIM:114290 : Campomelic dysplasia with autosomal sex reversal

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HMG domain which could be assigned to a KEGG orthologous group, and not all proteins containing HMG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamHMG_box
InterProIPR009071