The HSA domain within your query sequence starts at position 799 and ends at position 870, and its E-value is 1.31e-31.

PKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAKKLVRTVARHHEEKKLREERGKKEEQSRLRRIAA

HSA domain in helicases and associated with SANT domains
SMART ACC:	SM000573
Description:	-
InterPro ACC:	IPR014012
InterPro abstract:	The helicase/SANT-associated (HSA) domain is found in eukaryotic proteins, including Helicase SRCAP/p400/DOM [ PUBMED:16024792 ], Probable global transcription activator SNF2L2/brahma-homologue and Chromatin modification-related protein EAF1 [ PUBMED:15045029 … expand The helicase/SANT-associated (HSA) domain is found in eukaryotic proteins, including Helicase SRCAP/p400/DOM [ PUBMED:16024792 ], Probable global transcription activator SNF2L2/brahma-homologue and Chromatin modification-related protein EAF1 [ PUBMED:15045029 ]. While each family has the core sequences that define the HSA domain, they each also have additional sequences that distinguish these families from one another. For example, the sequence HWDY(L/C)EEEM(Q/V) is found in the SRCAP/p400/DOM family, whereas the sequence HQE(Y/F)LNSILQ is found in the SNF2 /brahma family [ PUBMED:16024792 ].HSA was initially predicted to be a DNA-binding domain [ PUBMED:11779830 ], but it was later reported to be responsible for the binding to nuclear actin-related proteins (ARPs) and actin [ PUBMED:18408732 ]. In addition to the SANT and helicase domains, the HSA domain is also found in association with the bromo domain [ PUBMED:11779830 ]. collapse
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 2 158 HSA domains in 2 154 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HSA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HSA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:	DNA-binding

Relevant references for this domain

Primary literature for the HSA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HSA domain which could be assigned to a KEGG orthologous group, and not all proteins containing HSA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterPro	IPR014012