The HMG17 domain within your query sequence starts at position 2 and ends at position 91, and its E-value is 3.18e-35.

PKRKAEGDGKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGRKGKAGKPTLGRMQDANNPAENGDAKTDQAQKDEGA
HMG17

HMG17

domain in high mobilty group proteins HMG14 and HMG 17
SMART ACC:SM000527
Description: -
InterPro ACC:IPR000079
InterPro abstract:

This entry represents the HMGN family, whose members promote chromatin unfolding, enhance access to nucleosomes, and modulate transcription from chromatin templates. HMGNs are expressed only in vertebrates [ PUBMED:25281808 ].

The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone … expand

GO component:nucleus (GO:0005634), chromatin (GO:0000785)
GO function:nucleosomal DNA binding (GO:0031492)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 175 HMG17 domains in 2 175 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HMG17 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HMG17 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HMG17 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HMG17 domain which could be assigned to a KEGG orthologous group, and not all proteins containing HMG17 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR000079
PROSITEHMG14_17
PfamHMG14_17