The DAGKc domain within your query sequence starts at position 372 and ends at position 495, and its E-value is 3.11e-62.

PLLVFINLKSGGKQGQSVLWKFQYILNPRQVFDLKDGPEPGLRFFKDVPQFRILVCGGDGTVGWVLETIDKANFATVPPVAVLPLGTGNDLARCLRWGRGYEGENLRKILKDIELSKVVYLDRW
DAGKc

DAGKc

Diacylglycerol kinase catalytic domain (presumed)
SMART ACC:SM000046
Description:Diacylglycerol (DAG) is a second messenger that acts as a protein kinase C activator. DAG can be produced from the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) by a phosphoinositide-specific phospholipase C and by the degradation of phosphatidylcholine (PC) by a phospholipase C or the concerted actions of phospholipase D and phosphatidate phosphohydrolase. This domain is presumed to be the catalytic domain. Bacterial homologues areknown.
InterPro ACC:IPR001206
InterPro abstract:

The DAG-kinase catalytic domain or DAGKc domain is present in mammalian lipid kinases, such as diacylglycerol (DAG), ceramide and sphingosine kinases, as well as in related bacterial proteins [ PUBMED:8626538 PUBMED:17351295 ]. Eukaryotic DAG-kinase … expand

GO function:kinase activity (GO:0016301)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 30 346 DAGKc domains in 30 334 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DAGKc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DAGKc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Diacylglycerol kinase

Relevant references for this domain

Primary literature for the DAGKc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DAGKc domain which could be assigned to a KEGG orthologous group, and not all proteins containing DAGKc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001206