The DUF1900 domain within your query sequence starts at position 258 and ends at position 365, and its E-value is 3.06e-53.

PLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKDTVSRLEEDV
DUF1900

DUF1900

SMART ACC:SM001167
Description:This domain is predominantly found in the structural protein coronin, and is duplicated in some sequences. It has no known function [(PUBMED:16172398)].
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 206 DUF1900 domains in 4 443 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1900 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1900 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1900 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1900 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF1900