The Sec63 domain within your query sequence starts at position 1813 and ends at position 2178, and its E-value is 6.37e-118.

PLTCGRIASYYYLKHKTVKMFKDRLKPECSTEELLSILSDAEEYTDLPVRHNEDHTNNELAKCLPIELNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAASQGWLVTVLNITHLIQMVIQGRWLKDSSLLTIPNIEQHHLHLFRKWKPPVKSSHAKCRTSIECLPELIHACEGKDHVFSSMVEKELQPAKTKQAWNFLSRLPVINVGISVKGSWDDLVEGHNELSISTLTADKRDENKWIKLHADQEYVLQVSLQRVHFGLPKGKHENHAVTPRFPKLKDEGWFLILGEVDKRELMAVKRVGFVRTHHDASISFFTPETPGRYIFTLYLMSDCYLGLDQQYDIYL
Sec63

Sec63

Sec63 Brl domain
SMART ACC:SM000973
Description:This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found. This protein is required for assembly of functional endoplasmic reticulum translocons (PUBMED:16368690), (PUBMED:11023840). Other yeast proteins containing this domain include pre-mRNA splicing helicase BRR2, HFM1 protein and putative helicases.
InterPro ACC:IPR004179
InterPro abstract:

This domain was named after the yeast Sec63 (or NPL1) (also known as the Brl domain) protein in which it was found. This protein is required for assembly of functional endoplasmic reticulum translocons [ PUBMED:16368690 PUBMED:11023840 ]. Other … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 838 Sec63 domains in 6 927 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Sec63 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Sec63 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Sec63 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Sec63 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSec63
InterProIPR004179