The BRO1 domain within your query sequence starts at position 115 and ends at position 449, and its E-value is 7.17e-103.

PMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQLQLAQEAAQVATEYGLVHRAMAQPPVRDYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKGELARQEHVFQPSTPHEPLGPTLPQHPEDRRKLGGGAAASHLVQSPAQGGPAAGCGDSGTAALPGQVLTARA
BRO1

BRO1

BRO1-like domain
SMART ACC:SM001041
Description:This domain is found in a number proteins including Rhophilin Q61085 and BRO1 P48582. It is known to have a role in endosomal targeting. ESCRT-III subunit Snf7 binds to a conserved hydrophobic patch in the BRO1 domain that is required for protein complex formation and for the protein-sorting function of BRO1 (PUBMED:15935782).
InterPro ACC:IPR004328
InterPro abstract:

The BRO1 domain is a protein domain of ~390 residues in length. It occurs in a number of eukaryotic proteins, such as yeast BRO1 and human PDCD6IP/Alix, which are involved in protein targeting to the vacuole or lysosome. The BRO1 domain of fungal and mammalian proteins binds with multivesicular body components (ESCRT-III proteins) such as yeast Snf7 and mammalian CHMP4b, and can function to target … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 823 BRO1 domains in 5 818 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BRO1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BRO1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the BRO1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BRO1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRO1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004328
PfamBRO1