The PolyA domain within your query sequence starts at position 554 and ends at position 617, and its E-value is 6.9e-42.

PPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH
PolyA

PolyA

C-terminal domain of Poly(A)-binding protein. Present also in Drosophila hyperplastics discs protein.
SMART ACC:SM000517
Description:Involved in homodimerisation (either directly or indirectly)
InterPro ACC:IPR002004
InterPro abstract:

The polyadenylate-binding protein (PABP) has a conserved C-terminal domain (PABC), which is also found in the hyperplastic discs protein (HYD) family of ubiquitin ligases that contain HECT domains ( IPR000569 ) [ PUBMED:11287654 ]. PABP … expand

GO function:RNA binding (GO:0003723)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 949 PolyA domains in 3 806 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PolyA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PolyA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PolyA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PolyA domain which could be assigned to a KEGG orthologous group, and not all proteins containing PolyA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002004