The FerB domain within your query sequence starts at position 820 and ends at position 894, and its E-value is 1.2e-48.

PQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPMEGMPGARMPVQIRIKLWFGL
FerB

FerB

SMART ACC:SM001201
Description:This is central domain B in proteins of the Ferlin family. PMID: 15112237
InterPro ACC:IPR012561
InterPro abstract:

The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease [ PUBMED:20667140 expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 031 FerB domains in 3 031 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FerB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FerB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FerB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FerB domain which could be assigned to a KEGG orthologous group, and not all proteins containing FerB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFerB
InterProIPR012561