The DUF3402 domain within your query sequence starts at position 466 and ends at position 662, and its E-value is 4.85e-24.

PRPIHESVKTLKQHKYISIADIQIKNEEELEKCPLSLGEEVVPETPSEILYQGMLYSLPQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPVTVLQSMKLGIDVNRHKEIIVKSISALLLLLLKHFKLNHIYQFEYVSQHLVFANCIPLILKFFNQNILSYITAKNSISVLDYPCCTIQDLPELTTESLGLSM
DUF3402

DUF3402

Domain of unknown function (DUF3402)
SMART ACC:SM001293
Description:This domain is functionally uncharacterised. This domain is found in eukaryotes. This presumed domain is typically between 350 to 473 amino acids in length. This domain is found associated with N1221.
InterPro ACC:IPR021819
InterPro abstract:

This domain can be found in the C terminus of the yeast Far11 protein and the human STRP1/2 proteins.

Budding yeast Far11 interacts with the phosphatases Pph21, Pph22, and Pph3 and may be involved in the regulation of autophagy and the DNA damage signaling [ PUBMED:22782902 ]. STRP1/2 (also known as FAM40A/B) … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 679 DUF3402 domains in 1 679 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF3402 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF3402 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF3402 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF3402 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF3402
InterProIPR021819