The VKc domain within your query sequence starts at position 12 and ends at position 160, and its E-value is 4.61e-44.

PRWERVARWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVSVVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED
VKc

VKc

SMART ACC:SM000756
Description:Family of likely enzymes that includes the catalytic subunit of vitamin K epoxide reductase. Bacterial homologues are fused to members of the thioredoxin family of oxidoreductases.
InterPro ACC:IPR012932
InterPro abstract:

Vitamin K epoxide reductase (VKOR) recycles vitamin K 2,3-epoxide to vitamin K hydroquinone, a co-factor that is essential for the posttranslational γ-carboxylation of several blood coagulation factors [ PUBMED:14765194 ]. VKORC1, the catalytic subunit of the VKOR complex, is a member of a large family of predicted enzymes … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 031 VKc domains in 5 031 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VKc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VKc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the VKc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VKc domain which could be assigned to a KEGG orthologous group, and not all proteins containing VKc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012932