The RanBD domain within your query sequence starts at position 302 and ends at position 430, and its E-value is 4.52e-13.

PSQKCLLEKIDVITGEETEHNVLKINCKIFVFNKATESWSERGQGILRLNDTAGRECGTLQSRLIMRNQGSLRLVLNSRLWAQMKIQRASQKNLRITATDLEDDGIKIFLIQASAKDTGFLYAAIHHRL
RanBD

RanBD

Ran-binding domain
SMART ACC:SM000160
Description:Domain of apporximately 150 residues that stabilises the GTP-bound form of Ran (the Ras-like nuclear small GTPase).
InterPro ACC:IPR000156
InterPro abstract:

Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran Binding Protein 1 (RanBP1) has guanine nucleotide dissociation inhibitory activity, specific for the GTP form of Ran and also functions to stimulate Ran GTPase activating protein(GAP)-mediated GTP hydrolysis by Ran. RanBP1 contributes to maintaining … expand

GO process:intracellular transport (GO:0046907)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 750 RanBD domains in 7 606 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RanBD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RanBD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding, RanGTP-binding

Relevant references for this domain

Primary literature for the RanBD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RanBD domain which could be assigned to a KEGG orthologous group, and not all proteins containing RanBD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000156