The CBM_2 domain within your query sequence starts at position 3 and ends at position 99, and its E-value is 1.02e-11.

PSQVTFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALINENETGDSVLWKAVIALNRGVSVKYRYFRGCFLEPKKVKSLLTMDSLASTGKAHTRGS
CBM_2

CBM_2

Starch binding domain
SMART ACC:SM001065
Description: -
InterPro ACC:IPR002044
InterPro abstract:

This entry represents which binds starch. The crystal structure of CBM20 has been solved [ PUBMED:1826034 ]. It consists of seven β-strands forming an open-sided distorted β-barrel. Several aromatic residues, especially the well-conserved Trp and Tyr residues, participate in granular starch binding.

A carbohydrate-binding … expand

GO function:starch binding (GO:2001070)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 317 CBM_2 domains in 6 379 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CBM_2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CBM_2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Starch binding domain

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CBM_2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing CBM_2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002044
PfamCBM_2