The Cyclin_C domain within your query sequence starts at position 145 and ends at position 270, and its E-value is 6.99e-7.

PTAAHFIEYYLSEAVHETDLHDGWPMVCLEKTKLYMAKYADYFLEVSLQAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLLAHDNDVKEANKQRGQSAPQSTQLTVFQTAQPSRPV
Cyclin_C

Cyclin_C

SMART ACC:SM001332
Description:Cyclins are a family of proteins that control the progression of cells through the cell cycle by activating cyclin-dependent kinase (Cdk) enzymes.
InterPro ACC:IPR004367
InterPro abstract:

Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [ PUBMED:12910258 ], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 14 939 Cyclin_C domains in 14 900 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Cyclin_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Cyclin_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the Cyclin_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Cyclin_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Cyclin_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCyclin_C
InterProIPR004367