The AP3B1_C domain within your query sequence starts at position 801 and ends at position 947, and its E-value is 4.58e-75.

PVAKEISLLDLEDFTPPSVQPVSPPMVVSTSLAADLEGLTLTDSSLVPSLLSPVSSIGRQELLHRVAGEGLSVDYAFSRQPFSGDPHMVSLHIYFSNNSETPIKGLHVGTPKLPAGISIQEFPEIESLAPGESTTTVMGINFCDSTQ
AP3B1_C

AP3B1_C

Clathrin-adaptor complex-3 beta-1 subunit C-terminal
SMART ACC:SM001355
Description:This domain lies at the C-terminus of the clathrin-adaptor protein complex-3 beta-1 subunit. The AP-3 complex is associated with the Golgi region of the cell as well as with more peripheral structures. The AP-3 complex may be directly involved in trafficking to lysosomes or alternatively it may be involved in another pathway, but that mis-sorting in that pathway may indirectly lead to defects in pigment granules (PMID:10024875).
InterPro ACC:IPR029390
InterPro abstract:

This domain lies at the C terminus of the clathrin-adaptor protein complex-3 beta-1 subunit. The AP-3 complex is associated with the Golgi region of the cell, as well as with more peripheral structures. Loss of functional AP-3 complex leads to defects in the function of lysosomes and lysosome-related organelles [ PUBMED:10024875 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 193 AP3B1_C domains in 1 191 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AP3B1_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AP3B1_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the AP3B1_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AP3B1_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing AP3B1_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

PfamAP3B1_C
InterProIPR029390