The PH domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

PVISSYATPTIPLSKAQTLLEEARLQTQLRDAEEEEGRDQFGWDDTQNKRNSNYPIEQD
PH

PH

Pleckstrin homology domain.
SMART ACC:SM000233
Description:Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
InterPro ACC:IPR001849
InterPro abstract:

Pleckstrin homology (PH) domains are small modular domains that occur in a large variety of proteins and they have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner, enabling them to interact with other components of signal transduction pathways. They share little sequence conservation, but all … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 196 127 PH domains in 171 590 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Inositol 1, 3, 4, 5-tetrakisphosphate-binding, phosphatidylinositol 4,5-bisphosphate-binding

Relevant references for this domain

Primary literature for the PH domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PH domain.

ProteinDescriptionDisease / phenotype
BTK_HUMANOMIM:300300 : Agammaglobulinemia, type 1, X-linked ; ?XLA and isolated growth hormone deficiency
OMIM:307200 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PH domain which could be assigned to a KEGG orthologous group, and not all proteins containing PH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPH_DOMAIN
InterProIPR001849
PfamPH