The LITAF domain within your query sequence starts at position 120 and ends at position 189, and its E-value is 4.1e-24.

PVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKR
LITAF

LITAF

Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
SMART ACC:SM000714
Description: -
InterPro ACC:IPR006629
InterPro abstract:

LITAF (LPS-induced TNF-activating factor) (also known as SIMPLE; small integral membrane protein of the late endosome) is an endosome-associated integral membrane protein important for multivesicular body (MVB) sorting. It is a monotypic membrane protein with both termini exposed to the cytoplasm and is anchored to membranes via an in-plane helical membrane anchor, present within the highly conserved … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 926 LITAF domains in 3 906 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LITAF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LITAF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LITAF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LITAF domain which could be assigned to a KEGG orthologous group, and not all proteins containing LITAF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR006629