The EH domain within your query sequence starts at position 262 and ends at position 357, and its E-value is 1.47e-40.

PWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLSEFCAAFHLIVARKNGYPLPEGLPPTLQPEYLQ
EH

EH

Eps15 homology domain
SMART ACC:SM000027
Description:Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
InterPro ACC:IPR000261
InterPro abstract:

The EH (for Eps15 Homology) domain is a protein-protein interaction module of approximately 95 residues which was originally identified as a repeated sequence present in three copies at the N terminus of the tyrosine kinase substrates Eps15 and Eps15R [ PUBMED:7568168 PUBMED:11911876 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 193 EH domains in 9 165 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Asn-Pro-Phe-containing proteins

Relevant references for this domain

Primary literature for the EH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EH domain which could be assigned to a KEGG orthologous group, and not all proteins containing EH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000261