The ICA69 domain within your query sequence starts at position 260 and ends at position 478, and its E-value is 1.25e-93.

PYEFTTLKSLQDPMKKLVEKEGKKTSWRENREAVAPEPRQLISLEDEHKDSSAYKTEEGTSVLSSVDKGSVHDTCSGPIDELLDGKPEEACLGPTAGTPEPESGDKDDLLLLNEIFSTSCLDEGEFSREWAAVFGDDQLKEPAPMGAQGEPDPKPQIGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA
ICA69

ICA69

Islet cell autoantigen ICA69, C-terminal domain
SMART ACC:SM001237
Description:This family includes a 69 kD protein which has been identified as an islet cell autoantigen in type I diabetes mellitus (PMID:8975715). Its precise function is unknown.
InterPro ACC:IPR006723
InterPro abstract:

This entry represents a C-terminal domain found in islet cell autoantigen Ica1. Ica1 has been identified as an islet cell autoantigen in type I diabetes mellitus [ PUBMED:8975715 ]. Its precise function is unknown, though it may play a role in neurotransmitter secretion [ PUBMED:11029035 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 020 ICA69 domains in 1 020 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ICA69 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ICA69 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ICA69 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ICA69 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ICA69 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR006723
PfamICA69