The BING4CT domain within your query sequence starts at position 439 and ends at position 517, and its E-value is 8.85e-53.

PYLTHRLSGHVHGLQFCPFEDVLGVGHSGGFTSMLVPGAAEPNFDGLENNPYRSRKQRQEWEVKALLEKVPAELICLNP
BING4CT

BING4CT

BING4CT (NUC141) domain
SMART ACC:SM001033
Description:This C terminal domain is found in the BING4 family of nucleolar WD40 repeat proteins.
InterPro ACC:IPR012952
InterPro abstract:

This C-terminal domain is found in the BING4 family of nucleolar WD40 repeat proteins [ PUBMED:15112237 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 501 BING4CT domains in 1 499 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BING4CT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BING4CT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BING4CT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BING4CT domain which could be assigned to a KEGG orthologous group, and not all proteins containing BING4CT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBING4CT
InterProIPR012952