The VHS domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

PYLVQPNVPEKHNMSTQADNSDDEELQKALKMSLFEYEKQKKLQEQEKESAEVLPQQQQQHQQQNQAPAHKIPAQ
VHS

VHS

Domain present in VPS-27, Hrs and STAM
SMART ACC:SM000288
Description:Unpublished observations. Domain of unknown function.
InterPro ACC:IPR002014
InterPro abstract:

The VHS domain is an about 150 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM. The VHS domain is found at the N- termini of proteins associated with endocytocis and/or vesicular trafficking, often in association with other domains like FYVE, SH3 or TAM [ PUBMED:9600884 expand

GO function:ubiquitin binding (GO:0043130), phosphatidylinositol binding (GO:0035091)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 698 VHS domains in 6 696 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VHS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VHS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the VHS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VHS domain which could be assigned to a KEGG orthologous group, and not all proteins containing VHS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002014
PfamVHS