The ACTH_domain domain within your query sequence starts at position 188 and ends at position 226, and its E-value is 8.53e3.

PYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAI
ACTH_domain

ACTH_domain

Corticotropin ACTH domain
SMART ACC:SM001363
Description: -
InterPro ACC:IPR013531
InterPro abstract:

Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin [ PUBMED:2266117 ]. ACTH regulates the synthesis and release of glucocorticoids and, to some extent … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 062 ACTH_domain domains in 1 577 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ACTH_domain domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ACTH_domain domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ACTH_domain domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ACTH_domain domain which could be assigned to a KEGG orthologous group, and not all proteins containing ACTH_domain domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

PfamACTH_domain
InterProIPR013531