The DEATH domain within your query sequence starts at position 558 and ends at position 654, and its E-value is 1.2e-25.

QAIFDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRIDLLNHLIRAS
DEATH

DEATH

DEATH domain, found in proteins involved in cell death (apoptosis).
SMART ACC:SM000005
Description:Alpha-helical domain present in a variety of proteins with apoptotic functions. Some (but not all) of these domains form homotypic and heterotypic dimers.
InterPro ACC:IPR000488
InterPro abstract:

The death domain (DD) is a homotypic protein interaction module composed of a bundle of six α-helices. DD is related in sequence and structure to the death effector domain (DED, see IPR001875 ) and the caspase recruitment domain (CARD, see IPR001315 expand

GO process:signal transduction (GO:0007165)
GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 756 DEATH domains in 10 503 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DEATH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DEATH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein-binding, homodimerization

Relevant references for this domain

Primary literature for the DEATH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DEATH domain which could be assigned to a KEGG orthologous group, and not all proteins containing DEATH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEDEATH_DOMAIN
InterProIPR000488
Pfamdeath