The DP domain within your query sequence starts at position 103 and ends at position 203, and its E-value is 4e-59.

QECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPAVNSTIQLPFIIINTSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVL
DP

DP

Transcription factor DP
SMART ACC:SM001138
Description:DP forms a heterodimer with E2F and regulates genes involved in cell cycle progression. The transcriptional activity of E2F is inhibited by the retinoblastoma protein which binds to the E2F-DP heterodimer [(PUBMED:16360038)] and negatively regulates the G1-S transition.
InterPro ACC:IPR014889
InterPro abstract:

The transcription factor DP (dimerization partner) forms a heterodimer with E2F and regulates genes involved in cell cycle progression. The transcriptional activity of E2F is inhibited by the retinoblastoma protein which binds to the E2F-DP heterodimer [ PUBMED:16360038 ] and negatively regulates the G1-S transition. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 503 DP domains in 1 502 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the DP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DP domain which could be assigned to a KEGG orthologous group, and not all proteins containing DP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014889
PfamDP