The DWA domain within your query sequence starts at position 36 and ends at position 144, and its E-value is 1.68e-66.

QEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPV
DWA

DWA

Domain A in dwarfin family proteins
SMART ACC:SM000523
Description: -
InterPro ACC:IPR003619
InterPro abstract:

Mammalian dwarfins are phosphorylated in response to transforming growth factor beta and are implicated in control of cell growth [ PUBMED:8799132 ]. The dwarfin family also includes the Drosophila protein MAD that is required for the function of decapentaplegic (DPP) and may play a role in DPP signalling. Drosophila … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 131 DWA domains in 7 116 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DWA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DWA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DWA domain which could be assigned to a KEGG orthologous group, and not all proteins containing DWA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003619
PfamDwarfin