The FATC domain within your query sequence starts at position 3797 and ends at position 3829, and its E-value is 1.89e-3.

QFDGGESKVNTLVAAANSLDNLCRMDPAWHPWL
FATC

FATC

SMART ACC:SM001343
Description:The FATC domain is named after FRAP, ATM, TRRAP C-terminal (PMID:10782091). The solution structure of the FATC domain suggests it plays a role in redox-dependent structural and cellular stability (PMID:15772072).
InterPro ACC:IPR003152
InterPro abstract:

This entry represents the FATC domain in Serine/threonine-protein kinases and related proteins, including pseudo-kinases such as members of the SAGA and NuA4 complexes. The TOR1 FATC domain, in its oxidised form, consists of an α-helix and a well-structured COOH-terminal disulphide-bonded loop. Reduction of the disulphide bond dramatically increases the flexibility within the COOH-terminal loop … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 901 FATC domains in 7 895 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FATC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FATC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FATC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FATC domain which could be assigned to a KEGG orthologous group, and not all proteins containing FATC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFATC
InterProIPR003152