The DRY_EERY domain within your query sequence starts at position 39 and ends at position 171, and its E-value is 1.28e-64.

QFLQVHGRACKVHLDSAVALAAESPVNMMPWQGDTNNMIDRFDVRAHLDHIPDYTPPLLTTISPEQESDERKCNYERYRGLVQNDFAGISEEQCLYQIYIDELYGGLQRPSEDEKKKLAEKKASIGYTYEDST
DRY_EERY

DRY_EERY

Alternative splicing regulator
SMART ACC:SM001141
Description:This entry represents the conserved N-terminal region of SWAP (suppressor-of-white-apricot protein) proteins. This region contains two highly conserved motifs, viz: DRY and EERY, which appear to be the sites for alternative splicing of exons 2 and 3 of the SWAP mRNA [(PUBMED:8206918)]. These proteins are thus thought to be involved in auto-regulation of pre-mRNA splicing. Most family members are associated with two SWAP (Surp) domains SM00648 and an Arginine- serine-rich binding region towards the C-terminus.
InterPro ACC:IPR019147
InterPro abstract:

This entry represents the conserved N-terminal region of SWAP (suppressor-of-white-apricot protein) splice factor proteins. This region contains two highly conserved motifs, viz: DRY and EERY, which appear to be the sites for alternative splicing of exons 2 and 3 of the SWAP mRNA [ PUBMED:8206918 ]. These proteins are … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 975 DRY_EERY domains in 1 973 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DRY_EERY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DRY_EERY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DRY_EERY domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DRY_EERY domain which could be assigned to a KEGG orthologous group, and not all proteins containing DRY_EERY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR019147
PfamDRY_EERY