The LINK domain within your query sequence starts at position 159 and ends at position 256, and its E-value is 7.26e-61.

QGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFT
LINK

LINK

Link (Hyaluronan-binding)
SMART ACC:SM000445
Description: -
InterPro ACC:IPR000538
InterPro abstract:

The link domain [ PUBMED:8318021 ] is a hyaluronan(HA)-binding region found in proteins of vertebrates that are involved in the assembly of extracellular matrix, cell adhesion, and migration. The structure has been shown [ PUBMED:8797823 ] to … expand

GO process:cell adhesion (GO:0007155)
GO function:hyaluronic acid binding (GO:0005540)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 282 LINK domains in 6 262 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LINK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LINK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LINK domain which could be assigned to a KEGG orthologous group, and not all proteins containing LINK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000538
PROSITELINK
PfamXlink