The IlGF domain within your query sequence starts at position 28 and ends at position 97, and its E-value is 1.32e-33.

QHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYC
IlGF

IlGF

Insulin / insulin-like growth factor / relaxin family.
SMART ACC:SM000078
Description:Family of proteins including insulin, relaxin, and IGFs. Insulin decreases blood glucose concentration.
InterPro ACC:IPR016179
InterPro abstract:

This entry represents a disulphide-rich α-helical domain found in insulin [ PUBMED:12595704 ], as well as in related proteins, such as insulin-like growth factor [ PUBMED:15642270 ], relaxin [ PUBMED:1656049 expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 123 IlGF domains in 4 108 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IlGF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IlGF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IlGF domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IlGF domain.

ProteinDescriptionDisease / phenotype
INS_HUMANOMIM:176730 : Diabetes mellitus, rare form ; MODY, one form ; Hyperproinsulinemia, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IlGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing IlGF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamins
PROSITEIlGF_DOMAIN
InterProIPR016179