The DZF domain within your query sequence starts at position 98 and ends at position 338, and its E-value is 5.01e-142.

QIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASY

DZF domain in DSRM or ZnF_C2H2 domain containing proteins
SMART ACC:	SM000572
Description:	-
InterPro ACC:	IPR006561
InterPro abstract:	This entry represents the DZF domain, which is found exclusively in metazoa. The DZF domain (domain associated with zinc fingers) is a dimerisation domain found in [ PUBMED:11438540 PUBMED:11779830 PUBMED:22833610 … expand This entry represents the DZF domain, which is found exclusively in metazoa. The DZF domain (domain associated with zinc fingers) is a dimerisation domain found in [ PUBMED:11438540 PUBMED:11779830 PUBMED:22833610 ]: Interleukin enhancer-binding factor 3 (also known as Nuclear factor of activated T-cells 90 kDa, NF90, DRBP76 or NFAR), contains two double-stranded RNA-binding motifs (dsRBMs) and interacts with highly structured RNAs as well as the dsRNA-activated protein kinase (PKR). Interleukin enhancer-binding factor 2 (also known as NF45), which appears to function predominantly as a heterodimeric complex with NF90. Spermatid perinuclear RNA-binding protein (SPNR, also known as STRBP), a testes specific paralogue of NF90. Zinc finger RNA-binding protein (Zfr). Nuclear factors NF90 and NF45 form a protein complex involved in a variety of cellular processes and are thought to affect gene expression both at the transcriptional and translational level. In addition, this complex affects the replication of several viruses through direct interactions with viral RNA. NF90 and NF45 dimerise through their common DZF domain. The DZF domain shows structural similarity to the template-free nucleotidyltransferase family of RNA modifying enzymes. However, the lack of conserved catalytic residues suggests that the DZF domain encodes a 'pseudotransferase' that is no longer able to catalyse transfer of nucleotides. The DZF dimerisation domain form an oblong structure with a flat face on one side and a curved face on the other. The DZF domain is bipartite and characterised by an N-terminal mixed α/β region that contains a central anti-parallel β-sheet and a C-terminal α-helical region. The overall structure has a pseudo two-fold rotational symmetry. The central β-sheet forms the base of a cleft between the N- and C-terminal halves while dimerisation is mediated by the α-helices at the C terminus [ PUBMED:22833610 ]. collapse
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 2 259 DZF domains in 2 259 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DZF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DZF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DZF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DZF domain which could be assigned to a KEGG orthologous group, and not all proteins containing DZF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterPro	IPR006561