The CKS domain within your query sequence starts at position 22 and ends at position 91, and its E-value is 8.74e-43.

QIYYSDKYDDEEFEYRHVMLPKDIDKLVPKTHLMSESEWRKLGVQQSQGWVHYMIHEPELHILLFQWPLP
CKS

CKS

Cyclin-dependent kinase regulatory subunit
SMART ACC:SM001084
Description:Cyclin-dependent kinase regulatory subunit.
InterPro ACC:IPR000789
InterPro abstract:

In eukaryotes, cyclin-dependent protein kinases interact with cyclins to regulate cell cycle progression, and are required for the G1 and G2 stages of cell division [ PUBMED:3322810 ]. The proteins bind to a regulatory subunit, cyclin-dependent kinase regulatory subunit (CKS), which is essential for their function. This … expand

GO function:cyclin-dependent protein serine/threonine kinase regulator activity (GO:0016538)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 999 CKS domains in 1 996 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CKS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CKS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CKS domain which could be assigned to a KEGG orthologous group, and not all proteins containing CKS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000789
PfamCKS