The BRLZ domain within your query sequence starts at position 253 and ends at position 317, and its E-value is 5.17e-8.

QKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSR
BRLZ

BRLZ

basic region leucin zipper
SMART ACC:SM000338
Description: -
InterPro ACC:IPR004827
InterPro abstract:

The basic-leucine zipper (bZIP) domain transcription factors [ PUBMED:7780801 ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region required for dimerisation.

Several structure of bZIP have been solved. The basic region and the leucine … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 52 073 BRLZ domains in 51 906 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BRLZ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BRLZ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BRLZ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BRLZ domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRLZ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfambZIP
PROSITEBZIP_BASIC
InterProIPR004827