The BBC domain within your query sequence starts at position 4 and ends at position 130, and its E-value is 4.3e-8.

QKEALQRIISTLANKSDEIQNFIDTLNHTLKGVQENSSNILSELDEEFDSLYSILDDVKESMISTIKQEQVRKSQELQSQLSQCNNALENSEELLEFATRSLDIKEPEEFSKAARQIKDRVTMASAF
BBC

BBC

B-Box C-terminal domain
SMART ACC:SM000502
Description:Coiled coil region C-terminal to (some) B-Box domains
InterPro ACC:IPR003649
InterPro abstract:

The B-box C-terminal domain is a coiled coil region C-terminal to (some) B-Box domains ( IPR000315 ). It is found in Tripartite motif-containing protein 2/3/67/66, E3 ubiquitin-protein ligase TRIM9/TRIM33/TRIM23/TRIM45/TRIM37, Fibronectin type III and similar proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 568 BBC domains in 6 536 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BBC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BBC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BBC domain which could be assigned to a KEGG orthologous group, and not all proteins containing BBC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003649