The GED domain within your query sequence starts at position 123 and ends at position 214, and its E-value is 9.51e-32.

QLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDI
GED

GED

Dynamin GTPase effector domain
SMART ACC:SM000302
Description: -
InterPro ACC:IPR003130
InterPro abstract:

This entry represents the dynamin GTPase effector domain (GED) found in proteins related to dynamin. Its C-terminal region constitutes one of the helices of the bundle signalling element (BSE) or neck together with the N- and C-terminal regions from the GTPase domain, being in close proximity and functionally linked to it. The N-terminal region of GED is part of the stalk domain [ expand

GO function:GTP binding (GO:0005525), GTPase activity (GO:0003924)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 230 GED domains in 6 213 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GED domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GED domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GED domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GED domain which could be assigned to a KEGG orthologous group, and not all proteins containing GED domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003130