The Longin domain within your query sequence starts at position 36 and ends at position 118, and its E-value is 1.87e-19.

QLKTLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAAMAFCFLEALWWDFIASYDTTCVGLASRPYAFLEFDSV
Longin

Longin

Regulated-SNARE-like domain
SMART ACC:SM001270
Description:Longin is one of the approximately 26 components required for transporting proteins from the ER to the plasma membrane, via the Golgi apparatus. It is necessary for the steps of the transfer from the ER to the Golgi complex (PUBMED:16855025). Longins are the only R-SNAREs that are common to all eukaryotes, and they are characterised by a conserved N-terminal domain with a profilin-like fold called a longin domain (PUBMED:15544955).
InterPro ACC:IPR010908
InterPro abstract:

VAMPs (and its homologue synaptobrevins) define a group of SNARE proteins that contain a C-terminal coiled-coil/SNARE domain, in combination with variable N-terminal domains that are used to classify VAMPs: those containing longin N-terminal domains (~150 aa) are referred to as longins, while those with shorter N-termini are referred to as brevins [ PUBMED:12914952 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 851 Longin domains in 6 843 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Longin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Longin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the Longin domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Longin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Longin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR010908
PfamLongin