The TAFH domain within your query sequence starts at position 102 and ends at position 192, and its E-value is 1.12e-53.

QLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLA
TAFH

TAFH

TAF homology
SMART ACC:SM000549
Description:Domain in Drosophila nervy, CBFA2T1, human TAF105, human TAF130, and Drosophila TAF110. Also known as nervy homology region 1 (NHR1).
InterPro ACC:IPR003894
InterPro abstract:

The TAF homology (TAFH) or Nervy homology region 1 (NHR1) domain is a domain of 95-100 amino acids present in eukaryotic proteins of the MTG/ETO family and whereof the core ~75-80 residues occur in TAF proteins. The transcription initiation TFIID complex is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs). The TAFH/NHR1 domain is named after fruit fly TATA-box-associated … expand

GO process:DNA-templated transcription (GO:0006351)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 238 TAFH domains in 2 237 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TAFH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TAFH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TAFH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TAFH domain which could be assigned to a KEGG orthologous group, and not all proteins containing TAFH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003894