The DIL domain within your query sequence starts at position 394 and ends at position 503, and its E-value is 6.19e-34.

QMLAYLFFFSGTLLLNQVLDKGPSLSCFHWPRGVQVCARLQQFLEWARSAGLGAPAERFFRKLSCTLHLLATPRAQLIQMSWATLRVTFPALNPAQLHRLLTQYQLASAM
DIL

DIL

SMART ACC:SM001132
Description:The DIL domain has no known function.
InterPro ACC:IPR002710
InterPro abstract:

The myosin superfamily consists of at least 15 distinct classes of presumed actin-based molecular motors. All members of the superfamily share a similar motor domain and a tail portion which is diagnostic of the class [ PUBMED:11212352 ].

Class V myosins are actin-based molecular motors that function in relatively … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 872 DIL domains in 6 863 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DIL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DIL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DIL domain which could be assigned to a KEGG orthologous group, and not all proteins containing DIL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002710
PfamDIL