The RPOLD domain within your query sequence starts at position 42 and ends at position 170, and its E-value is 2.3e-5.

QNRFEKVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPRLFEYRNQGEEEGTEIDTLQFRLQVRCTRNPNAAKDSSDPNELYVNHKVYTRHMTWVPLGNQADVFPEGTIRPVHDDILIAQLRPGQ
RPOLD

RPOLD

RNA polymerases D
SMART ACC:SM000662
Description:DNA-directed RNA polymerase subunit D and bacterial alpha chain
InterPro ACC:IPR011263
InterPro abstract:

The core of the bacterial RNA polymerase (RNAP) consists of four subunits, two alpha, a beta and a beta', which are conserved from bacteria to mammals. The alpha subunit (RpoA) initiates RNAP assembly by dimerising to form a platform on which the beta subunits can interact, and plays a direct role in promoter recognition [ PUBMED:10972792 expand

GO process:DNA-templated transcription (GO:0006351)
GO function:DNA-directed RNA polymerase activity (GO:0003899)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 23 040 RPOLD domains in 23 040 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPOLD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPOLD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the RPOLD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPOLD domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPOLD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRNA_pol_A_bac
InterProIPR011263