The SWIB domain within your query sequence starts at position 307 and ends at position 386, and its E-value is 1.3e-21.

QPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDP
SWIB

SWIB

SWI complex, BAF60b domains
SMART ACC:SM000151
Description: -
InterPro ACC:IPR019835
InterPro abstract:

The SWI/SNF family of complexes, which are conserved from yeast to humans, are ATP-dependent chromatin-remodelling proteins that facilitate transcription activation [ PUBMED:11147808 PUBMED:22952240 PUBMED:26791088 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 075 SWIB domains in 4 496 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SWIB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SWIB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SWIB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SWIB domain which could be assigned to a KEGG orthologous group, and not all proteins containing SWIB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019835