The IL10 domain within your query sequence starts at position 49 and ends at position 179, and its E-value is 7.88e-1.

QPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
IL10

IL10

Interleukin-10 family
SMART ACC:SM000188
Description:Interleukin-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells.
InterPro ACC:IPR020443
InterPro abstract:

This entry represents the interleukin-10, interleukin-19, interleukin-20, interleukin-24 and interleukin-26 family.

Interleukin-10 (IL-10) is a protein that inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells. Structurally, IL-10 is a protein of about 160 amino acids that contains four … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 073 IL10 domains in 1 072 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IL10 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IL10 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IL10 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IL10 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamInterleukin10
PROSITEINTERLEUKIN_10
InterProIPR020443