The EFG_C domain within your query sequence starts at position 681 and ends at position 768, and its E-value is 1.9e-20.

QVLEPLMSLEVTVSREYLSPVLADLAQRRGNIQEIQTRQDNRVVLGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMSPQDQSAL
EFG_C

EFG_C

Elongation factor G C-terminus
SMART ACC:SM000838
Description:This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
InterPro ACC:IPR000640
InterPro abstract:

Elongation factor 2 (EF2 or EFG) is folded into five domains, with domains I and II forming the N-terminal block, domains IV and V forming the C-terminal block, and domain III providing the covalently-linked flexible connection between the two [ PUBMED:11054294 ]. This entry represents the domain V of EF2 of both prokaryotes … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 76 176 EFG_C domains in 76 171 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EFG_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EFG_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EFG_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing EFG_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEFG_C
InterProIPR000640