The Int_alpha domain within your query sequence starts at position 448 and ends at position 496, and its E-value is 1.49e-3.

QYSYLGYSLAVLHKAHGVSYVAGAPRHKLRGAVFELRKEDREEDAFVRR
Int_alpha

Int_alpha

Integrin alpha (beta-propellor repeats).
SMART ACC:SM000191
Description:Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Alpha integrins are proposed to contain a domain containing a 7-fold repeat that adopts a beta-propellor fold. Some of these domains contain an inserted von Willebrand factor type-A domain. Some repeats contain putative calcium-binding sites. The 7-fold repeat domain is homologous to a similar domain in phosphatidylinositol-glycan-specific phospholipase D.
InterPro ACC:IPR013519
InterPro abstract:

Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Alpha integrins are proposed to contain a domain containing a 7-fold repeat that adopts a β-propeller fold. Some of these domains contain an inserted von Willebrand factor type-A domain. Some repeats contain putative calcium-binding sites. The 7-fold … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 70 993 Int_alpha domains in 14 903 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Int_alpha domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Int_alpha domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Int_alpha domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the Int_alpha domain.

ProteinDescriptionDisease / phenotype
ITA2B_HUMANOMIM:273800 : Glanzmann thrombasthenia, type A ; Thrombocytopenia, neonatal alloimmune
ITA2_HUMANOMIM:192974 : Neonatal alloimmune thrombocytopenia ; ?Glycoprotein Ia deficiency

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Int_alpha domain which could be assigned to a KEGG orthologous group, and not all proteins containing Int_alpha domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamintegrin_A
PROSITEInt_alpha_DOMAIN
InterProIPR013519