The CENPB domain within your query sequence starts at position 256 and ends at position 323, and its E-value is 3.93e-21.

RAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRR
CENPB

CENPB

Putative DNA-binding domain in centromere protein B, mouse jerky and transposases.
SMART ACC:SM000674
Description: -
InterPro ACC:IPR006600
InterPro abstract:

The CENPB-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 70-75 amino acids, present in eukaryotic centromere proteins and transposases. The domain is named after the mammalian major centromere autoantigen B or centromere protein B (CENP-B), which is a fundamental centromere component of chromosomes. The N terminus of CENP-B contains two DNA-binding HTH domains, which … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 067 CENPB domains in 7 852 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CENPB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CENPB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Transcription
Binding / catalysis:DNA-binding?

Relevant references for this domain

Primary literature for the CENPB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CENPB domain which could be assigned to a KEGG orthologous group, and not all proteins containing CENPB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006600