The Mob1_phocein domain within your query sequence starts at position 33 and ends at position 207, and its E-value is 1.93e-105.

RAQASLNSGVDLRAAVQLPNGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEDIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPL
Mob1_phocein

Mob1_phocein

Mob1/phocein family
SMART ACC:SM001388
Description:Mob1 is an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Mob1 contains no known structural motifs; however MOB1 is a member of a conserved gene family and shares sequence similarity with a nonessential yeast gene, MOB2. Mob1 is a phosphoprotein in vivo and a substrate for the Mps1p kinase in vitro. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature (PMID:9436989). This family also includes phocein Q9QYW3 a rat protein that by yeast two hybrid interacts with striatin (PMID:11251078).
InterPro ACC:IPR005301
InterPro abstract:

The MOB kinase activator family includes MOB1, an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature [ PUBMED:9436989 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 928 Mob1_phocein domains in 5 923 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Mob1_phocein domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Mob1_phocein domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the Mob1_phocein domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Mob1_phocein domain which could be assigned to a KEGG orthologous group, and not all proteins containing Mob1_phocein domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMob1_phocein
InterProIPR005301