The CSP domain within your query sequence starts at position 644 and ends at position 707, and its E-value is 2.2e-16.

RATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGVELQAGDEVEFSVILNQRTGKCSACNVWRV
CSP

CSP

Cold shock protein domain
SMART ACC:SM000357
Description:RNA-binding domain that functions as a RNA-chaperone in bacteria and is involved in regulating translation in eukaryotes. Contains sub-family of RNA-binding domains in the Rho transcription termination factor.
InterPro ACC:IPR011129
InterPro abstract:

A conserved domain of about 70 amino acids has been found in prokaryotic and eukaryotic single-strand nucleic-acid binding proteins [ PUBMED:1622933 PUBMED:2184368 PUBMED:8022259 expand

GO function:nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 80 336 CSP domains in 70 472 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CSP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CSP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA-binding

Relevant references for this domain

Primary literature for the CSP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CSP domain which could be assigned to a KEGG orthologous group, and not all proteins containing CSP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011129
PROSITECOLD_SHOCK
PfamCSD