The PKD domain within your query sequence starts at position 930 and ends at position 1008, and its E-value is 1.06e-8.

RAVPSPEARVLQGILVRYSPMVEAGSDVAFRWTIDDKQSLTFHNTVFNVIYQSAAIFKLSLTASNHVSNITVNYNVTVE
PKD

PKD

Repeats in polycystic kidney disease 1 (PKD1) and other proteins
SMART ACC:SM000089
Description:Polycystic kidney disease 1 protein contains 14 repeats, present elsewhere such as in microbial collagenases.
InterPro ACC:IPR022409
InterPro abstract:

The PKD (Polycystic Kidney Disease) domain was first identified in the Polycystic Kidney Disease protein, polycystin-1 (PDK1 gene), and contains an Ig-like fold consisting of a β-sandwich of seven strands in two sheets with a Greek key topology, although some members have additional strands [ PUBMED:9889186 ]. Polycystin-1 … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 95 746 PKD domains in 42 890 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PKD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PKD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PKD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PKD domain which could be assigned to a KEGG orthologous group, and not all proteins containing PKD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR022409
PfamPKD